PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr033333.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 444aa    MW: 49051.9 Da    PI: 5.4501
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr033333.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS295.51.4e-90474322373
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fsevsPilkfshlt 97 
                  ++lLl+cA a++s+d +laq++++ l++ as+ gdp+qRl++ +++AL +r ++  ++ ++    s+++++  s+ +++++l  ++++ P+++f++ +
  Pbr033333.1  47 EKLLLHCASALESNDVTLAQQVMWVLNNVASSVGDPNQRLTSWILRALISRASKVFPTPMNFN-GSSSTSTIPSRLMSVTELagYVDLIPWHRFGYCA 143
                  689***************************************************777777654.44444445666666666689************** PP

         GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvlvak.rledl.. 189
                   N+aI +a+eg+ +vHi+Df+i++++QWp+L++aL +R+egpp lRiT+ +   ++    + + ee+g rL +f +  +vpfefnv+  + +le l  
  Pbr033333.1 144 SNSAICKAIEGCPKVHILDFSITHCMQWPTLIDALEKRAEGPPLLRITVPHWRPQVpplLNVSSEEVGLRLGNFSRFRNVPFEFNVIENSsSLELLlg 241
                  *************************************************99866668999999***********************944436665566 PP

         GRAS 190 ...eleeLrvkpgEalaVnlvlqlhrll.........desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                     ++++L ++++E+l+Vn++  l +l          ++++s    r+++L++++sl+P+++vvv++++d++++s+  r++ +++y +  fdsle+ l
  Pbr033333.1 242 tqlNPSSLGLREDEVLVVNCQNWLRYLSdeplggipgHQDGS---MRNTFLNTIRSLNPRIIVVVDEDSDLTAPSLSSRITTCFNYLWIPFDSLETFL 336
                  6669************************44444443333334...666************************************************** PP

         GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  p++s +r+++E   +g +i+n++  eg++r+er e+  + ++rl++ GF+++p+ e++ak++k+ll +++  g+ ++ e++ lvl+Wk+++ v+++aW
  Pbr033333.1 337 PKDSTQRMNYESD-VGHKIENIIGFEGQQRIERLESGVTMSQRLRNIGFSSAPFCEETAKEVKALLDEHA-SGWGMKREEDMLVLTWKGHNSVFATAW 432
                  *************.********************************************************.889999999****************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.0920414IPR005202Transcription factor GRAS
PfamPF035144.7E-8847432IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MKTEVRGSIT SVSLQNPSTA LFTTSQGKSL TGALTGCLGS LDGACIEKLL LHCASALESN  60
DVTLAQQVMW VLNNVASSVG DPNQRLTSWI LRALISRASK VFPTPMNFNG SSSTSTIPSR  120
LMSVTELAGY VDLIPWHRFG YCASNSAICK AIEGCPKVHI LDFSITHCMQ WPTLIDALEK  180
RAEGPPLLRI TVPHWRPQVP PLLNVSSEEV GLRLGNFSRF RNVPFEFNVI ENSSSLELLL  240
GTQLNPSSLG LREDEVLVVN CQNWLRYLSD EPLGGIPGHQ DGSMRNTFLN TIRSLNPRII  300
VVVDEDSDLT APSLSSRITT CFNYLWIPFD SLETFLPKDS TQRMNYESDV GHKIENIIGF  360
EGQQRIERLE SGVTMSQRLR NIGFSSAPFC EETAKEVKAL LDEHASGWGM KREEDMLVLT  420
WKGHNSVFAT AWVPNPNALL IED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-25444322374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009341443.10.0PREDICTED: scarecrow-like protein 32
TrEMBLM5WVY80.0M5WVY8_PRUPE; Uncharacterized protein (Fragment)
STRINGPOPTR_0007s02880.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100743142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-124GRAS family protein